SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7N6X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7N6X0
Domain Number 1 Region: 4-52,181-266
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000303
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7N6X0
Sequence length 445
Comment (tr|A0A0C7N6X0|A0A0C7N6X0_9SACH) LALA0S05e02256g1_1 {ECO:0000313|EMBL:CEP62292.1} KW=Complete proteome; Reference proteome OX=1245769 OS=Lachancea lanzarotensis. GN=LALA0_S05e02256g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MNASETDRLPTLHEVLNRQTTTPVDLWSFYTFLSQYPYAINFLDFWIDTMAHLRLCKDYV
RGIRESVAEWEEVQEKSKTSEGSNNNDTNNRSAETPENRESMSSSMLLEALMNDGLLDFE
DSKRVSQFLQGQTDSPRLTRLLENWQKHTDQDLHEDAPFRSPLTGLVDDFLKTQAHDTRK
AQITSKQLQGNAKTIVDTYLRSPINSPRYLINLPDHMRQQALHMVVTEQRHVPDVFEPLK
SLAYQFLEMECFPQFLSSVALHNLHDDLTQEAKTSRSHDANGSLRRTTNPFAHYTSLSRI
VLGMVFLWLGLWLGYVLVFLNYNRGIRVTTIVLFFLGFYFIWTGIYKVDILYALCGVSQS
LVSNELVSNKDLEIGLNRNSANHRMGYRAPIFLRLFGGASRLVKIRNPLVDSMIKRRAWW
CFFLIIVGTAIFTVIFSCVPGYRLQ
Download sequence
Identical sequences A0A0C7N6X0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]