SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7NAJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7NAJ8
Domain Number 1 Region: 212-332
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-31
Family cAMP-binding domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 340-451
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-31
Family cAMP-binding domain 0.00041
Further Details:      
 
Domain Number 3 Region: 11-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7NAJ8
Sequence length 466
Comment (tr|A0A0C7NAJ8|A0A0C7NAJ8_9SACH) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1245769 OS=Lachancea lanzarotensis. GN=LALA0_S08e03598g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MPLTGGQLEELNLFHRKVHEDEPKDLLQFAANYFNRRLEQQRFFARNQESLALSKGIVLF
PSATRNDSVVASASAAAGLKGAESQSNDQIFKASFAETDPHATGAAASIQEAGMAPDTVS
SEEGSEMAGFGSGIFKDNFRVNKSSDKHIKKPVDPMAPADQAGSSPQPTTAPRRSVAVPR
PLPMNFNAQRRTSVSGETMQPDNLDDWKPENYSEKTGLQLERLEKAIGRNFLFNKLDTES
KRLVINSLEEKSVKEGKEIIKQGDEGDYFYIVERGNVDFFVGSQKVNTSGPGSSFGELAL
MYNSPRAATVLATTDCVLWALDRLTFRRILLGSSFKKRILYDELLKSMPVLQSLTTYDRA
KLADALDTEIYQPGQIIIREGDSGDNFYFIEFGEAEVSKEQHGIIAHLKQGDYFGEVALL
NDLPRQATVKAIKKTKVATLGKSGFQRLLGPAVEVLKLNDPTRVDH
Download sequence
Identical sequences A0A0C7NAJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]