SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9LWW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9LWW6
Domain Number 1 Region: 30-74,151-243
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000555
Family Regulator of G-protein signaling, RGS 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9LWW6
Sequence length 361
Comment (tr|A0A0C9LWW6|A0A0C9LWW6_9FUNG) RGS domain-containing protein {ECO:0000313|EMBL:GAN09240.1} KW=Complete proteome; Reference proteome OX=91626 OS=Mucor ambiguus. GN=MAM1_0253d08764 OC=Mucoraceae; Mucor.
Sequence
MVTELYLNENDTIHPLSRVANSKIESVLDQLPTLDDVLHRQSQPPVCLYNYYIVLRDRLE
LEILLDFWLDVAQADILYKRYMKYANKRASTKFSSPKLPKPSISSSILDYHHRQSNNSNS
NDILTHMLLLHPRASLATTMYSTTTNGSQPKRPPPTQTEMMEAIERIYLRYIVPSAEKEI
VQLPVSIKESIGHHFYDSEKKDPSLYTGHPENPIIYAQAKEYVHQLLESTFPLFLRYKVF
MNLTLPQQIGRLACGLVLLLVGFSLEFSLIFLNIHPWQKRLWGILPIILGVFCVITSITG
IDPVWVLGFNLSETVPFQFNHIVHCRVRAILRRRSIVVSAIILFTTLVFMIFFCAVAGKR
L
Download sequence
Identical sequences A0A0C9LWW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]