SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9LYY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9LYY5
Domain Number 1 Region: 454-546,632-662
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.18e-20
Family Regulator of G-protein signaling, RGS 0.0018
Further Details:      
 
Domain Number 2 Region: 225-306
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000599
Family DEP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9LYY5
Sequence length 736
Comment (tr|A0A0C9LYY5|A0A0C9LYY5_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:GAN11475.1} KW=Complete proteome; Reference proteome OX=91626 OS=Mucor ambiguus. GN=MAM1_0623c11038 OC=Mucoraceae; Mucor.
Sequence
MPKTDNSFATYTSMMRVTKNGRPFAKDLYDMFAAVLLQINLKDHRVMFRTYPYTFTTDEA
AKVMESLVFIHVHRNPDPANPSRQIATRTTTTFSMDFSTAKHMLQQFLSARLIVSATDPT
NWNIRDKGLWCPTLKGKYVMEEFTDSTQVEMTDTLIAALNAPYMSPGASGSTGSRIITLD
RMVDNDDQITFARANMTAAFRAMMSSIPRDALLIDDVGGVEKKSFGIFQYSFVGSHCVEW
LCNRLTVTSVEEAESVAAEFLLFGWIAQILNKADKTYGTKEDDITFRTARNAIYYVTERG
CIVTGWKPPTAEEPIQGGNQSNSSGLSLDSDASSTKKTIHRGVTKPTPPLAPPPPSVMPK
YSYYDSTDNENAKNQAALGPTDMIRHDSATALIEQALSQSSLSQDNSSMEGGPDVQRHPS
QRPPSMSVTDTTVPPNSAASNTASANVNKENSQWTRLTQILETPLLRLYFREFLRSNYSE
ENINFWVSHNKLLKNIKQNNKTVLEQLAECYTIYRTYLGYDATADVNIDHVLHQEITKYV
TTVFVVVNSTAAIGTTANAAPGTNGSLPLKNPYFIVAPTNHPTLTTNQPINSSKASNRLL
LMPPSVANGSKQRIVTIHGVSPERCLIKLLRLFGKVNDHVCRMMAEDSVPKFIKTERYRK
LIAKQQSDALATETDDEDDSDDLSYEDSSDEDEDRRHLTHLTTALSAQRSFMDHQRHETN
INATPSIATITTTSAI
Download sequence
Identical sequences A0A0C9LYY5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]