SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9M4C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9M4C7
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily WWE domain 0.000017
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9M4C7
Sequence length 124
Comment (tr|A0A0C9M4C7|A0A0C9M4C7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:GAN01129.1} KW=Complete proteome; Reference proteome OX=91626 OS=Mucor ambiguus. GN=MAM1_0005d00560 OC=Mucoraceae; Mucor.
Sequence
MVIWFFENNHFANAWIPFDRSNQKKLEYVYRHHEEIVQLWSQKQNDTTAPLIKNTVIDLD
EEDDSIHPDIQYDHSCIYINLKDSHFEHNITLYPTMLLGSLPDRDILIIRAEMMDHKNNK
YLLE
Download sequence
Identical sequences A0A0C9M4C7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]