SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9PK74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9PK74
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.14e-27
Family Insect pheromone/odorant-binding proteins 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9PK74
Sequence length 133
Comment (tr|A0A0C9PK74|A0A0C9PK74_9HYME) Obp56a protein {ECO:0000313|EMBL:JAG71190.1} OX=64838 OS=Fopius arisanus. GN=g.9731 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MKVFLVLFSVCLAAVMAQQISDIQKETLRENRDACITETGADRAEVDNAYKNEWVDNEKL
RCFALCLLKKWKMMDDQGKLDETMARERMGKVMPPAKVDELMTKCKDLKGSNPCETGYMM
MKCYTGNIAPAAV
Download sequence
Identical sequences A0A0C9PK74
XP_011311566.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]