SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9PQS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9PQS3
Domain Number 1 Region: 71-123
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000334
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9PQS3
Sequence length 215
Comment (tr|A0A0C9PQS3|A0A0C9PQS3_LACPA) Uncharacterized protein {ECO:0000313|EMBL:GAN37341.1} KW=Complete proteome OX=1435038 OS=Lactobacillus paracasei NRIC 0644. GN=LC0644_1930 OC=Lactobacillus.
Sequence
MMLQPWPNLIPRPDLPTIPKTAAIPPAYFKLIQTGILPMNWWLPTKEPTSDAIDGVGIHA
FATVGPAMTSSDLPAHFLPFAKTGHQYFGFDLQQEPRQIRYIDTEVDQWLTVAMDLPAFM
KQLQPHEAKLPEISVDPQIFGHMAVIATAAEWPALFDYAREFMAGQAIGPWLRWLAQSKE
EAKRQVGMEEFHFLTRYQPNFLTPNDTLTLQHVFG
Download sequence
Identical sequences A0A0C9PQS3 A0A0E2BMS6 A0A0E2M213 A0A0R1FAQ7 A0A1F1JPJ5 A0A243PSU6 A0A2I5ML34 K6QHM3 K6R4Q7 Q034T4 S2P6J9 S2QFV1 S2RUB1 S4ZQW1
gi|523515182|ref|YP_008201266.1| 321967.LSEI_2565 gi|116495996|ref|YP_807730.1| gi|532357840|ref|YP_008447674.1| gi|301067548|ref|YP_003789571.1| WP_003571475.1.100311 WP_003571475.1.101073 WP_003571475.1.11857 WP_003571475.1.12579 WP_003571475.1.16432 WP_003571475.1.16871 WP_003571475.1.18077 WP_003571475.1.1932 WP_003571475.1.2136 WP_003571475.1.22898 WP_003571475.1.24721 WP_003571475.1.25941 WP_003571475.1.26583 WP_003571475.1.29913 WP_003571475.1.31893 WP_003571475.1.348 WP_003571475.1.39238 WP_003571475.1.44983 WP_003571475.1.45488 WP_003571475.1.46604 WP_003571475.1.48252 WP_003571475.1.49406 WP_003571475.1.49750 WP_003571475.1.54691 WP_003571475.1.56780 WP_003571475.1.6012 WP_003571475.1.60703 WP_003571475.1.64430 WP_003571475.1.65183 WP_003571475.1.66157 WP_003571475.1.67371 WP_003571475.1.67564 WP_003571475.1.6844 WP_003571475.1.69447 WP_003571475.1.698 WP_003571475.1.7166 WP_003571475.1.73866 WP_003571475.1.74597 WP_003571475.1.78295 WP_003571475.1.80634 WP_003571475.1.86624 WP_003571475.1.91063 WP_003571475.1.91737 WP_003571475.1.94863 WP_003571475.1.98013 WP_003571475.1.99959 YP_807730.1.65993 368039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]