SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9PRL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9PRL9
Domain Number 1 Region: 8-47
Classification Level Classification E-value
Superfamily SAP domain 0.00000000244
Family SAP domain 0.0029
Further Details:      
 
Domain Number 2 Region: 242-291
Classification Level Classification E-value
Superfamily RING/U-box 0.000000272
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 184-221
Classification Level Classification E-value
Superfamily SAP domain 0.00000427
Family SAP domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9PRL9
Sequence length 297
Comment (tr|A0A0C9PRL9|A0A0C9PRL9_9HYME) Rffl_0 protein {ECO:0000313|EMBL:JAG73750.1} OX=64838 OS=Fopius arisanus. GN=g.12953 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MLSRRPLIRSQILKMKSKDLKQYLVAKKVSVRGCVEKDDLIDILMVYANGGDNQRSNATE
SIPNNQQSSDRPSTVPDSPVRRSRSPPVLVRQVSESVAQESSPSPTRRVHPDIEITEISS
EDEQSISQGPAPVVTEHDNDEEPVTYVSTRVDNCRESHSSETPSICTEIPIWRGTIKIAD
IHVRSDLEYLNVKQLKDLLRKNRVDFRGCVERSELLDRASRLWDAHKQSRQDCTTGDMNA
AEDPYEENLCRICWDSPIECVILECGHMACCLECGKQMNECPICRQYVVRVVRFFKA
Download sequence
Identical sequences A0A0C9PRL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]