SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9QF26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9QF26
Domain Number 1 Region: 3-47
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000349
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9QF26
Sequence length 227
Comment (tr|A0A0C9QF26|A0A0C9QF26_9HYME) PAPD7 protein {ECO:0000313|EMBL:JAG82865.1} OX=64838 OS=Fopius arisanus. GN=g.26799 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MIDGHRPSILCIEDPLTPGNDIGRSSYGALYVQNAFDYAYSVLSEAVSPLNVLVNDAYKL
SILGRIVRVTDEVVEYRKWIKETFPPSISELDSLSSSTGSDASTLSAPASDTDSECSRGN
SPNTGSKVDDRNKDRNAYNNHNSNQNHHWKKPYKPSGHVNHQHNSRGTYPRGMNNNNLSQ
NKMKNAQHNTNSNTQNNNGGSQSPGSRVQGPKRKKFVSHRAPGDCMR
Download sequence
Identical sequences A0A0C9QF26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]