SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9QY06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9QY06
Domain Number 1 Region: 187-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-85
Family Protein kinases, catalytic subunit 0.0000000000221
Further Details:      
 
Domain Number 2 Region: 30-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-44
Family Regulator of G-protein signaling, RGS 0.00000114
Further Details:      
 
Domain Number 3 Region: 553-668
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-16
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9QY06
Sequence length 687
Comment (tr|A0A0C9QY06|A0A0C9QY06_9HYME) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} OX=64838 OS=Fopius arisanus. GN=g.64138 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MADLEAVLADVSYLMAMEKSKCTPAARASKKIILPDPSVRSVMHKYLEKKNEVNFDKIFN
QVLGYLLFKDFCETVAEEPIPQLRFYEEIKSYEKLECPDERRKLAREIYDNYIMKELLAH
SHEYSSEAVAHVHKYLMKNEVPVNLFEPYIEEIFNHLRGETFRKFLESDKYTRFCQWKNL
ELNIQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGVDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFNEPEMKFYAA
EVILGLDHMHRRYIVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAP
EVLSKGTAYDSSADWFSFGCMLYKLLKGHSPFRQHKTKDKHEIDRMTLTMNVELPESFSR
ELRSLLEGLLQRDITTRLGCRGRGADELKEHPFFGGIDWQQVYLQKYTPPFVPPRGEVNA
ADAFDIGSFDEEDTKGIKLTDADQDLYKNFPLVISERWQSEVSETVFETINNEADKVENK
RKAKQKLRFDADEKGSDCILHGYIKKLGGPFASAWQTRYAKLYPNRLELHPESTTKPELV
FLDQVEEVSPDLQNVKGEQCIVVRTREAKIVLTNPDEISLKEWALSLRSAYKNSMEMLGN
MARKAGKIYGTERDAVIPPIQRSANGN
Download sequence
Identical sequences A0A0C9QY06
XP_011308946.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]