SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9R138 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9R138
Domain Number 1 Region: 45-85
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000209
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9R138
Sequence length 174
Comment (tr|A0A0C9R138|A0A0C9R138_9HYME) EFCAB10 protein {ECO:0000313|EMBL:JAG71457.1} OX=64838 OS=Fopius arisanus. GN=g.5848 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MLASDDKEDEKSKAPTEGLNFTIDSPRTQTTDTENDYTYPSSTHEQAERYLANHKIYELL
NFLIGHLLVEEPDDPIEFLDNLLNKCMLFKSDMDEPPLLFTTRHIASLFQSLNPSGSGRI
SLEQYKIGMKTLGITNYDQCPVECTPGYVDKHTFEDQAKKCLIKSLTEMVGKCE
Download sequence
Identical sequences A0A0C9R138
XP_011300717.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]