SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9R4T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9R4T5
Domain Number 1 Region: 373-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.28e-40
Family Regulator of G-protein signaling, RGS 0.0000319
Further Details:      
 
Domain Number 2 Region: 77-182
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-29
Family DEP domain 0.0079
Further Details:      
 
Domain Number 3 Region: 305-361
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000068
Family Transducin (heterotrimeric G protein), gamma chain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9R4T5
Sequence length 515
Comment (tr|A0A0C9R4T5|A0A0C9R4T5_9HYME) RGS7_3 protein {ECO:0000313|EMBL:JAG81063.1} OX=64838 OS=Fopius arisanus. GN=g.43172 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MVTMSSEKSASRRKPIDSSGSCSKNTNEQHNASGKCRIGTTSKRKEETTTADATVKSGAV
DRPKSTATCAEDSPNYVVYKKMESIVEKMLDETNGVPVRTAKTFMTKIPSVFTGTDLIAW
MMKNMDIDDQEALRVAHLMASHGYFFPIDDHCLTVKNDNTFYRFQTPYFWPSNCWEPENT
DYAVYLCKRTMQNKTRLELADYEAENLARLQKMFSRKWEFIFMQAEAQSKVDKKRDKLER
KVLDSQERAFWDVHRPMPGCVNTTELDIKKACRTNKPMVKASKHLQLGVAGGRISPTHAD
ADITLSSESIQREIDMLKQRLDRRNIKVSKVAEALIGYFEQYVEYDPLFTQPEFNNPWIS
DSTELWEQEKIAKDISARRVKRWGFSLQELLQDPIGKEQFVKFLEMEYSSENLKFWEAVQ
NLKTLPQRDVQAKVEEIWNEYLRPDASCPINVDSRSFELTKRNLEKPDRWSFDVAAAHVY
HLMKTDSYARYLRSEMYRDFLNGSKKKILRFAFKF
Download sequence
Identical sequences A0A0C9R4T5
XP_011298887.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]