SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9R5D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9R5D9
Domain Number 1 Region: 82-142
Classification Level Classification E-value
Superfamily BPTI-like 0.000000653
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily BPTI-like 0.0000511
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9R5D9
Sequence length 144
Comment (tr|A0A0C9R5D9|A0A0C9R5D9_AMBAM) Putative secreted protein {ECO:0000313|EMBL:JAG92175.1} OX=6943 OS=Amblyomma americanum (Lone star tick). GN= OC=Amblyomma.
Sequence
MMLYFLALSLVGAVSGLGHRQCPQRMLQNTRSDCLIEDWTFYYIYKNDTGECVQQKACEP
DLQGNDIFTKKEDCLEACYDLVKDPCIFAHYANFNACPYGEKAWRYSYNKTSRKCVGFMG
STCYDGSINLFYTERKCQQECKNK
Download sequence
Identical sequences A0A0C9R5D9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]