SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9R833 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9R833
Domain Number 1 Region: 28-114
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 6.28e-22
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9R833
Sequence length 120
Comment (tr|A0A0C9R833|A0A0C9R833_9HYME) Tpk1_1 protein {ECO:0000313|EMBL:JAG82326.1} OX=64838 OS=Fopius arisanus. GN=g.31058 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MATINTLYKSKTLMGDNHVEKIILVSGNSLSWLLRAGKHRIKIPEILHEKNSWAGLIPMG
CTANASTTGLKWNPSTPLNFGGMVSTSNTYDGSPEVTVNTDSDIIWTMGIEPLLEMTNIC
Download sequence
Identical sequences A0A0C9R833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]