SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9RHS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9RHS6
Domain Number 1 Region: 54-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.07e-17
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 2-37
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000126
Family ECR1 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9RHS6
Sequence length 138
Comment (tr|A0A0C9RHS6|A0A0C9RHS6_9HYME) Exosc1_1 protein {ECO:0000313|EMBL:JAG76273.1} OX=64838 OS=Fopius arisanus. GN=g.50223 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
QRLCPASKTSLSGPGTYELTGYIYAKLAGTVEILNDESTKTIIVHGTTEQSIVPAPGDVV
TAMVTLVNQRFCKCIMKCIGDTVLTRTYRGILRKEDVRATEKDRVEMYKSFRPGDIILAR
VVSFFILHKITKGICNES
Download sequence
Identical sequences A0A0C9RHS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]