SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9RUI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9RUI7
Domain Number 1 Region: 9-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.69e-49
Family Calponin-homology domain, CH-domain 0.000000769
Further Details:      
 
Domain Number 2 Region: 199-262
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.84e-20
Family EB1 dimerisation domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9RUI7
Sequence length 282
Comment (tr|A0A0C9RUI7|A0A0C9RUI7_AMBAM) Putative microtubule-binding protein involved in cell cycle control {ECO:0000313|EMBL:JAG91086.1} OX=6943 OS=Amblyomma americanum (Lone star tick). GN= OC=Amblyomma.
Sequence
MGEQGPLCVNVHATNATTENLSRHDMLHWVNDCLRTNYTKIEELCSGAAYCQFMDMLFPG
SVSLRKVKFKTNLEHEYIQNFKLLQASFKKVGVDKNIPVDRLIKGRFQDNFEFVQWFKKF
FDANYDGRQYDPVEARGNTSVIGTATSGSTSRIANNHKVAASRPVHATKPMTRNTPVSKP
IGAATRITGSTGAGDSHRLEELSNQIAELKTTVDGLEKERDFYYGKLRDIEVLCQECEQK
HGKSQVVDQILEILYATEEGFSVPEDYVEDGGPVAAGEEEEY
Download sequence
Identical sequences A0A023FH66 A0A0C9RUI7 A0A1E1XU76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]