SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9SDB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9SDB6
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily t-snare proteins 9.42e-16
Family t-snare proteins 0.0022
Further Details:      
 
Domain Number 2 Region: 125-194
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000121
Family SNARE fusion complex 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9SDB6
Sequence length 227
Comment (tr|A0A0C9SDB6|A0A0C9SDB6_AMBAM) Putative vesicle transport through interaction with t-snares protein {ECO:0000313|EMBL:JAG90833.1} OX=6943 OS=Amblyomma americanum (Lone star tick). GN= OC=Amblyomma.
Sequence
MSSEKFEDLEEDFVALMEEIRRKLESAKGRGGIGESKKSLLREVQRKVDQASGVLQELEH
EARAAPNPYRVHMNSKTRKYRSELDDINKTAASLAGGVTHVTIARQDLLSPSSVLGDFGA
GDPQRSRLLQMNETLDRTTDSLARTFQVAAETDQIGTAVAEELRTQRESLVRTKERLEET
DQNLSTSRKILRTMYRRVMTNKMILIMIIVIEICILGALIYWKFIMK
Download sequence
Identical sequences A0A0C9SDB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]