SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9T2S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9T2S2
Domain Number - Region: 259-362
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000805
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9T2S2
Sequence length 396
Comment (tr|A0A0C9T2S2|A0A0C9T2S2_9HOMO) Unplaced genomic scaffold SPHSTscaffold_735, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ23088.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_276407 OC=Sphaerobolus.
Sequence
MFYLSYLLNTDPKSGRQKVEWSNHFECSHASTYRDARDTNLSPSKQRNCAPSPKYCCDAK
ILISKLCTSDLLEIRDFWKHNNHNPVQLRDMQESRNPDAVHEWLHTRVNKSFNQKAIKAM
LQMSSEELAELKVDNTSLPYSIKISTLDIYNAVRQKAKHETILAPEIGESVKLWMEQLGG
PDGPPFMSRHLVRRTVVVIHSPLFHRGKQSLTQPYYLIGEYANAMCLDSTQNTCKGVDKE
KVTGKGVPLTFMLTRYESHCPLEHFLKWLQQECSFEPESITIDCSDTEALGINKSIPDRA
IMIIYCYWHLWQAWEKNITPKFHITFEGVRRKEVRSELLKDLQDILGRLLHAGTAEDFET
HWEFMQTEYGRHPAWINIWKTNMSSIKNGGLRLGGW
Download sequence
Identical sequences A0A0C9T2S2
jgi|Sphst1|276407|gm1.38297_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]