SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9TH27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9TH27
Domain Number 1 Region: 55-86,122-209
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000518
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9TH27
Sequence length 657
Comment (tr|A0A0C9TH27|A0A0C9TH27_PAXIN) Unplaced genomic scaffold PAXINscaffold_17, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ15010.1} KW=Complete proteome; Reference proteome OX=664439 OS=Paxillus involutus ATCC 200175. GN=PAXINDRAFT_12276 OC=Paxillus.
Sequence
MAQPPASKLSFRGLFTLPYRLCNPPPAVGKVRSCSVTPVLHVRLDDVLARQHLPPIGLKD
FEEYLLYAEQAPENLYFILWLKEYTSRYQTWAQRARKASLVHNQKHGDAPSSRRLNFRNP
PAPDPSLALFYARAKQTFFTPNAEYELNIPSDILAPFHCLPQSSAFQSRNCAPAFAWHSQ
SAHPDPAVFTEVAIEVRIMLHESLCRFVRAAYTNVGSRRAACGIVAGCVCTLVAGVLPLV
MTSGRWNIGPHGRLIRLVAFPGLWFGLTILIASLQGICLMVYIFGDLRQLRKFELARPAI
SRPMPMPISAPVVSRVPPVNGPSISISRNHQVEKDPEEALPTSPVTITSVSSFAAQSHPF
SRTSEASSATSCESGESESCSSGDCNEIDVSPAFFDDVPAPEGPATASCLHRPEYRPSSV
TFLPTVHPRPRNYPTISTGSIHAEPGAISRNTESAFRGEVEYGPSAVFIPPDFIGDSATT
GTQRSRSGAESFDFDLLPTTRHTISLRRSNVRLNGDATATPAPSPGRTTIPLSTISNGSN
HSAGISPSGGVGPVMGRVQYKCNNRLHPLSHSPDSGASVQNLHSMTPTPSQERSRPTSSF
ALLIPSFTSGVPAFASPFTQVRSPVVKRAQWEVVVRAGLLAAIGAGVITGVVVGVVP
Download sequence
Identical sequences A0A0C9TH27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]