SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9UKH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9UKH4
Domain Number - Region: 33-108
Classification Level Classification E-value
Superfamily eIF4e-like 0.0549
Family BLES03-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9UKH4
Sequence length 126
Comment (tr|A0A0C9UKH4|A0A0C9UKH4_9HOMO) Unplaced genomic scaffold SPHSTscaffold_324, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ25760.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_55807 OC=Sphaerobolus.
Sequence
MLLLISIVTGLTTGQQGTNLPNMLHKIAKRSNPDVLTEKKQSKAIWAVTHLGLAISLVGG
VRLLVFEANCSVDYLWESQQLPVSEYLLCITVYVTLEGTEGARRVMIWGLPEDEEQDSEP
TSESTQ
Download sequence
Identical sequences A0A0C9UKH4
jgi|Sphst1|55807|fgenesh1_pg.324_#_2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]