SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9UXA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9UXA0
Domain Number - Region: 11-28
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0889
Family Huristasin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9UXA0
Sequence length 111
Comment (tr|A0A0C9UXA0|A0A0C9UXA0_9HOMO) Unplaced genomic scaffold SPHSTscaffold_77, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ39494.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_49637 OC=Sphaerobolus.
Sequence
MDMGNEESTHFYCEIGHYAWREGCEICFEKQDSEDEDSASEDDRRSEDHVFPTSLNEKIY
WKSLDTLKLINSNIDSEVVKHFLMARSQIGAPLRSLYRDCVLPSKLEWFKA
Download sequence
Identical sequences A0A0C9UXA0
jgi|Sphst1|49637|fgenesh1_pg.77_#_71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]