SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9UYX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9UYX0
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000000173
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9UYX0
Sequence length 131
Comment (tr|A0A0C9UYX0|A0A0C9UYX0_9HOMO) Unplaced genomic scaffold scaffold_137, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ58199.1} KW=Complete proteome; Reference proteome OX=994086 OS=Hydnomerulius pinastri MD-312. GN=HYDPIDRAFT_34409 OC=Hydnomerulius.
Sequence
MKTESLGQLLMDFLEYYGHHFPYETYYVSVADHTIVPKAGQDWIKNDPGRLSVQCLANLE
RDLTKSAHRIEEVKDGFKDSFRLMKECTTPSMHGTAAWGGLLKSLKRNGGNTLRTLLCLG
NWSQIFEFSTL
Download sequence
Identical sequences A0A0C9UYX0
jgi|Hydpi2|34409|gm1.11564_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]