SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9W0K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9W0K0
Domain Number 1 Region: 311-392
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.28e-18
Family Cytochrome b5 0.0039
Further Details:      
 
Weak hits

Sequence:  A0A0C9W0K0
Domain Number - Region: 245-271
Classification Level Classification E-value
Superfamily FnI-like domain 0.0698
Family Fibronectin type I module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9W0K0
Sequence length 417
Comment (tr|A0A0C9W0K0|A0A0C9W0K0_9HOMO) Acyl-CoA desaturase {ECO:0000256|PIRNR:PIRNR000345} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_251556 OC=Sphaerobolus.
Sequence
MATRINSPHRKALIKRLDPINVTLFVGPHFVTLLGFWTTPLQWKTFILAFVYLCIISTAF
IAGYHRLWPHRSFNPTKSLEYTIAFFGSAACIRSSLHYARHHRAHHRYIDSELDPYMPTH
NFFWRHCGWFAVKQSNVAEVDVSDVLSNPVVQWQVKWLWPLTIISSFILPVLVAGLGWGD
WWGGFFYAGFMRVSYMHHGVAYANSLAHWLGDHHFDDRTSPRDFLLTNILTFGEGYHNFH
HQFPMDYRCGIEWWQFDPTKWFLYACYCLGFVTQLSRAPQNEVRKAELSMELKKLRNVQD
RIKWASAPEDLPVVDWEKFQEESTTRPLVLIAGFIHDVSSFIDEHPGGRYMLAGNIGKDV
TTSFFGGIYNHSNAAHNIMSMLRVGVLKGGVQHVDEIIPPGEQMRIVHTKEIKQTSF
Download sequence
Identical sequences A0A0C9W0K0
jgi|Sphst1|251556|gm1.13446_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]