SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9W8S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9W8S5
Domain Number - Region: 133-183
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00589
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9W8S5
Sequence length 323
Comment (tr|A0A0C9W8S5|A0A0C9W8S5_9HOMO) Unplaced genomic scaffold scaffold_52, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ59506.1} KW=Complete proteome; Reference proteome OX=994086 OS=Hydnomerulius pinastri MD-312. GN=HYDPIDRAFT_100543 OC=Hydnomerulius.
Sequence
MHYSVSHFYHRSLVSIIREKVLDPAHHRLFHYEPYELRWHPPHKPHDIRVYGELFTSSAF
LEAHCKLQDSPAEPESDLPRRIIALMFWSDATQLTSFGNAKLWPVYMYFGNVSKYKRCQP
PSHLCTHAAYLQTLPNDFKDFALEHSGCKLPGDAFFTHCHHELFHAQWQELLDDDFVQAY
EHGMVLTCCDGIQWRLFPRIFTYSADYPEKVLIANICNLGSCPCPRCLISKDHLHNLASE
RDILQHHALACRDTEERRKKVVDARRLIYDQQYVVDTPQVEALLKEESLVPTKNAFSERL
SHVGFDFFLMLVVDLLHEFELGV
Download sequence
Identical sequences A0A0C9W8S5
jgi|Hydpi2|100543|e_gw1.52.48.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]