SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9XU29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9XU29
Domain Number 1 Region: 405-505,534-567
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-30
Family Regulator of G-protein signaling, RGS 0.00072
Further Details:      
 
Domain Number 2 Region: 206-336
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000052
Family DEP domain 0.037
Further Details:      
 
Domain Number 3 Region: 36-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000565
Family MukF N-terminal domain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9XU29
Sequence length 632
Comment (tr|A0A0C9XU29|A0A0C9XU29_9AGAR) Unplaced genomic scaffold K443scaffold_7, whole genome shotgun sequence {ECO:0000313|EMBL:KIK08446.1} KW=Complete proteome; Reference proteome OX=1095629 OS=Laccaria amethystina LaAM-08-1. GN=K443DRAFT_1537 OC=Laccaria.
Sequence
MPATADNDPQATSSHMMKTTKRGRPFLKDTLDLFATLIVSLQLGPHKQFFRTFPHSFSTD
EAAQNLASLKFSQSNRGPDPREPSRVVTTTTTTTFSMTRDMAKAMSQHFMDARLIENAAD
PNSNLFKDRGVYQLTPKGLHVLERFISKNGINSDHLQQVFSSQPICIKLLHLERRSADDE
IIVTQSVITALFRRFVGRQPNYPPPADKPLDAFQKYNERSKGIALMDVTERAQPLMGKGQ
QTHKCCFAAVSALEWLCDFTSVVGREEAAEMAAQFVRFGLITLVSDKRKNNDSAIIFTVR
GSAPGGNSPVSQVGEFRCTAKAIYKITDEGRRLAHWDGSRPLGVQGSPNASSSNLMTERA
SVDGSVDSLPDSGKRRGADAKIHRRISLAEKMNATYDAAERKSTKESNTDRLRYILEEPG
LRSLFREFLRGNFSEENLSFWVDVQDFKRKNTPGQAAMERHHESLINTAFVIYNTYLAPS
SQCELNIDHGLRNELVKYLEDVVTNLTGKAFQGRVEPEQANAFNATQLQTMIRLYERIQT
HIFRLMATDSVPKFIKTPKFLAMRNWVEDFDPTENDIHLLTVGPTSPPGLNTSDEVGGAY
ITISQQASEREHRQQVAQAATVKQHSNSSSTS
Download sequence
Identical sequences A0A0C9XU29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]