SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9Y603 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9Y603
Domain Number 1 Region: 56-165
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 6.67e-25
Family Steroid-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9Y603
Sequence length 170
Comment (tr|A0A0C9Y603|A0A0C9Y603_9AGAR) Unplaced genomic scaffold K443scaffold_23, whole genome shotgun sequence {ECO:0000313|EMBL:KIK05617.1} KW=Complete proteome; Reference proteome OX=1095629 OS=Laccaria amethystina LaAM-08-1. GN=K443DRAFT_674913 OC=Laccaria.
Sequence
MELLGFSVDLGSPVNTALFLYILYSVQKIIFPPIAKPTKVPNEFKGGYTWMPKAHPPTVL
YRIYTPKTLEPFSGKDGGRILLAINGTVFDVTAGRNFYGPNGMYGNFAGRDASRGMAKQS
FDFDMLTPVDAPVDPLTDLAPDEIDNMKGWVEHFSNKYIICGKLVENDAL
Download sequence
Identical sequences A0A0C9Y603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]