SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9YE35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9YE35
Domain Number 1 Region: 32-241
Classification Level Classification E-value
Superfamily t-snare proteins 1.91e-38
Family t-snare proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9YE35
Sequence length 285
Comment (tr|A0A0C9YE35|A0A0C9YE35_9AGAR) Unplaced genomic scaffold K443scaffold_6, whole genome shotgun sequence {ECO:0000313|EMBL:KIK08707.1} KW=Complete proteome; Reference proteome OX=1095629 OS=Laccaria amethystina LaAM-08-1. GN=K443DRAFT_672235 OC=Laccaria.
Sequence
MSRDRLAASRAHRSQTMEMSNLVSTSPAGGSSSLFLSEVANIQDGIRHYNENVSRISVLR
SQLLNEPNAEGSEQLDSLAEENRNLSQDLKGRIQRLAQQPQGQDAELRRNQIALLQSKFM
EAIQNYQLIEKENRAKSRQRVERQLKIVKPDATPEEVAAAFEGGDEQIFAQALTTSTRYG
ESRAAYREVQGRQEDLRKMEQTLAELAQLFIDMGTLIEQQEAVITAVEDTARDVEGNTEK
ALQHTSEATDHARSYRKGRWICFFISLFVVCVLALVLGLVFGTKK
Download sequence
Identical sequences A0A0C9YE35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]