SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9YKD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9YKD5
Domain Number - Region: 233-289
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0161
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9YKD5
Sequence length 309
Comment (tr|A0A0C9YKD5|A0A0C9YKD5_9HOMO) Unplaced genomic scaffold scaffold_727, whole genome shotgun sequence {ECO:0000313|EMBL:KIK10822.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_123859 OC=Pisolithaceae; Pisolithus.
Sequence
MNPYFPYPNKGVLRLGNWYWNQGAQKSRESFKQLIDIVGDSSFSPAVVAHTLWDAIDDQL
GHNQFDGNQPEWLEEDHGWKCSLVTISVPFHNRAKDPGPKNYTVNGFYHRSLTSIIREAV
TNPVCVQHFHFVPYELRWRPAHRDHDVKVHGELFTSTAFLEAHQELQDSPQEPGCDLPRV
IAALMFWSDSTQLAQFGSAKLWPLYVFFGNESKYQRCQPSNHLCSHVAYFQVLPDEFKDF
LMEHFGGKYPGDILTTHCNREFFHEQWKILLDDDFIAAYKPGIVIICCDGIKQRFYLRIF
TYSADYPEK
Download sequence
Identical sequences A0A0C9YKD5
jgi|Pismi1|123859|e_gw1.727.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]