SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9YYD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9YYD9
Domain Number - Region: 17-51
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00981
Family Crystallins/Ca-binding development proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9YYD9
Sequence length 52
Comment (tr|A0A0C9YYD9|A0A0C9YYD9_9HOMO) Unplaced genomic scaffold scaffold_218, whole genome shotgun sequence {ECO:0000313|EMBL:KIK15187.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_687441 OC=Pisolithaceae; Pisolithus.
Sequence
RPRPRRRVEAIGAARAALQCTFVEEVASQRVPENCLRLYDYCLHSGHYQYLG
Download sequence
Identical sequences A0A0C9YYD9
jgi|Pismi1|687441|fgenesh1_kg.218_#_13_#_Pisolithus_microcarpus_c12743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]