SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9Z0W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9Z0W7
Domain Number 1 Region: 18-127
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-24
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0016
Further Details:      
 
Weak hits

Sequence:  A0A0C9Z0W7
Domain Number - Region: 157-240
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0314
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9Z0W7
Sequence length 353
Comment (tr|A0A0C9Z0W7|A0A0C9Z0W7_9HOMO) Unplaced genomic scaffold scaffold_188, whole genome shotgun sequence {ECO:0000313|EMBL:KIK15927.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_114302 OC=Pisolithaceae; Pisolithus.
Sequence
MAPKSALFEGEKTTVKSAISSEGSKILFATPARIYFAHPRKDKWTYGGLQGALALVEDLS
KSAHFVKLVDIFGSGGVIWSHEIYEGFELNQDKSFFYSFAGDSCMIGLVFSDEKDAKTLH
KKLTSRKATKGSVKTSNTVSKGGKIDKSMISGPVGGSFKHVAHMEFDMEKGFITEGVDQS
WGQLAAELHKDYGIPKALVEANTDFIRGFFETAKRNGRIEATQEPPKKKPPPPPVPRRGT
HGPSASVTSTNGDAEPTAATPASPARPGRADLLASIRGQSVHNLRKTPKVDSNATSTPTP
APDETSTRGSDGGATTTAGGGDLTAALAAALLQRNKKLGDSDDEDEDDDDDWD
Download sequence
Identical sequences A0A0C9Z0W7
jgi|Pismi1|114302|e_gw1.188.63.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]