SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9ZNE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9ZNE9
Domain Number 1 Region: 23-101,133-230,1194-1273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-24
Family ABC transporter ATPase domain-like 0.034
Further Details:      
 
Domain Number 2 Region: 944-1024,1085-1275
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.7e-21
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 
Weak hits

Sequence:  A0A0C9ZNE9
Domain Number - Region: 1363-1399,1434-1518
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000271
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9ZNE9
Sequence length 1987
Comment (tr|A0A0C9ZNE9|A0A0C9ZNE9_9HOMO) Unplaced genomic scaffold scaffold_12, whole genome shotgun sequence {ECO:0000313|EMBL:KIK27454.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_22103 OC=Pisolithaceae; Pisolithus.
Sequence
MSSLNKLAIRGIRSFDDKQISVIEFFSPVTVIVGHNGSGKTTVIECLKYATTGDQPPNTR
GGAFVHDPKMANEKEVKAQVKLRFHAANGNRMLVVRNLSVTAKKTGLTMKTLESILALAD
SNIEKGGKRGAISTKCAEIDTEIPHLLGVSKSVLENVIFCHQEDSYWPLAEPSILKKKFD
DIFEATRYTKALDSIKALRKDRMADLKAEKERLESLAKEKAHADKLRVRTTDLNSSITSK
QDQYDETKRQYEQLVKNNARFYESATKFREMYVKVENLQQKKEHYQQELADARETVREME
GSDDELQNRLHNFDENIAQLKQKRSRREEERQDLEGGLTKARKTHVELVNEQGELAAEAK
AHERRIAEREELIRDISDKQNIKGYSHSPLEREKVNEFISRLGDLQRRQHADYKKLQAEV
RAKNDEFNRQSRQLHTEVESLKLQRGNAQDQIKERQASIARTESSLVTMQGLAPELRTLR
GDIEEKKLRLEKIKGEIKSANFDERLSERAVKARTMEDKRDSLNTELRSLSLQADARARL
DLKRGEMKSKKSEVRNILETSNPKFRKLVGADVRAETMERELDRLSREKDQELSEAETEL
SSANKTLQSSETTLSQAKAQLRNKHKEIKELDRRIKEATDLNFSGMPLLDAIKEAEREVA
EKKEKASLSAGMTRVYENLLNIGRVRKRCATCDRHMDPKEMAVFEKFLQEQIRRTKGAPE
IDKDTESSSVEAWESELESLRKALPHQASKDRILGLEIPALEKEIKATEVEIQPLSETAE
KAAQNVEQVKKEIRDITVLKQQAATVSRNLSDIERLTTETANLEEELSATGSVKTADDVQ
VELDNLSSEIRTNERERQAIMAERDRLNSSLRTCESELHAMEKKENTLSNQIREKDLMEE
RVDAMTKEIANLNARLRELDVKLAEAQAPIGRLEQEYQQVQNDLNIRVAEVQRSSQELNM
SVDKLDGINRIVDRYVREERGLLLAECGEKIERYQSEIQEISMKVENIRENIAKIDKEIN
ESGSSISNLRDNLRIRKLVKDIAATQAEIDSYDMESAAKAKRTFDDRYQAEKQKETDMQS
KYAHLGGEISSLNETLKQVEKDLREYKDTNKRYTDQLVKVKMSDMANNDLEKYAKALDNL
KMEEVNDTMRHLWNKTYQGTDIDGIKIRSDVEGGASKRSYNYRVVMTKDQVEMDMRGRCS
AGQKMLASIIIRLALSDSFGQNCGILALDEPTNALDVENIDALAESLVDIINERKNHSNF
QLIIITHDETFLRKLGQSDVMEYYCAELTERSMQASVARLETEVGDRASAIPVKTWPPAS
KLTLRGLLTLPYRLCNPPPAIGKVRSCSVTPVLQVRLDDVLDRKHLPPLGLKDFEEYLLY
VEQAPENLYFLLWLKEYTIRYQAWAQRAKATFANDTLRVGNVPSSPRRLLRNPPPPDPSL
TLFYSRAKQTFFTPFADYELNIPSDILGPFHSSTSQSRPPGSPAPWHSQSAHPDPAVFTE
VAIEARFMLNESLQRFVHAASTNVGSRRAACGIAGGTFFTTVTGVLPLVMTTGRWNAGPH
GRLVRLAAVPGLWFGLTILIASFQGICLMIYVFGDLRQLRKFELARPMISRPLPTSISEP
FLQVSRAPPLHTPIPSVQPQRSNPVTISPVTATANTVSSASPDCRPFSSASARSSATSRE
SYETESACSDGANEIEISAAVFDEDPAPEGPATATCLHRPEYQAPPPPSSATFPALAHLP
PRARPVVSAPNIRGAFDRARNGDGISKADSRYGPTAGFIQPSTNGDTEGQSSSWRSFTPH
KSRGTFQNFDFDLLPSTRRSVSTRESSGRPRIDVVTTASASPSTTHVQSVRQPCSRENGV
QLSAPPRHFVTTNALSSELGRVQYKCNKRPCPISIPPNSAAFLSSPSHHAPSSPSTSMPV
PEKEHRNFPFPFNLPSFTAGVPAFAAPLTDIQSPVVKRAQWEVVVRSGMIAFLITGAIVG
VIIGVVP
Download sequence
Identical sequences A0A0C9ZNE9
jgi|Pismi1|22103|fgenesh1_pg.12_#_40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]