SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0A5V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0A5V7
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.14e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00011
Further Details:      
 
Domain Number 2 Region: 79-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.06e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0A5V7
Sequence length 170
Comment (tr|A0A0D0A5V7|A0A0D0A5V7_9HOMO) Unplaced genomic scaffold scaffold_4, whole genome shotgun sequence {ECO:0000313|EMBL:KIK29832.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_443131 OC=Pisolithaceae; Pisolithus.
Sequence
MFFIKELTHTILLHPSYFGPRMLQFLESKLYADVEGTCSGQYGYIIAVVSILDIGRGMVV
NGSGQAEFITRYRAIVFKPFKGEVVDGVVNNVNKMGFFADVGPLQVFISHQLIHPEMKFD
PNSNPPSFASDDQIIEKNTRVRLKIVGTRVDATEIFAIGTIKEDHLGVID
Download sequence
Identical sequences A0A0D0A5V7
jgi|Pismi1|443131|CE318679_3046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]