SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0AHH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0AHH9
Domain Number 1 Region: 52-154
Classification Level Classification E-value
Superfamily PWI domain 2.35e-34
Family PWI domain 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0AHH9
Sequence length 273
Comment (tr|A0A0D0AHH9|A0A0D0AHH9_9HOMO) Unplaced genomic scaffold CY34scaffold_311, whole genome shotgun sequence {ECO:0000313|EMBL:KIK37574.1} KW=Complete proteome; Reference proteome OX=930992 OS=Suillus luteus UH-Slu-Lm8-n1. GN=CY34DRAFT_451867 OC=Suillus.
Sequence
MTGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVCHRSQAAPCSKLNFYLVPQVDLK
KVNLNVIRPWIAKKVTELVGLEDEVVVEYAMGLLDDPNHTTPDPKKMQINLTGFLTASTP
SFMTALWSLLLEAQEHPAGVPQTFVEEKKEEMRKAREGDVRAIEVNVQAADVEGAEAEAE
VDLKVVAEAEITVGVDAVAVVLAAECLAAHRPIAGAHRLRALHLTQGVPGPHLLLSDVRV
LQGVPDPAVLCTAETPLPVDPGRAHPPFVADAP
Download sequence
Identical sequences A0A0D0AHH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]