SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0CUI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D0CUI4
Domain Number - Region: 24-86
Classification Level Classification E-value
Superfamily LigB-like 0.0217
Family LigB-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0CUI4
Sequence length 106
Comment (tr|A0A0D0CUI4|A0A0D0CUI4_9HOMO) Unplaced genomic scaffold scaffold_1554, whole genome shotgun sequence {ECO:0000313|EMBL:KIK79108.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_162173 OC=Paxillus.
Sequence
GNFKAEHLYGRKTDRQVWFMGGLGFMVSWSPYHEYLAATNHSPERFSCNNHSEVNQANSL
HAWLEATGIRATVCAHHGCFVPHSVVDFQKGERCAFAKFSRVLFLC
Download sequence
Identical sequences A0A0D0CUI4
jgi|Paxru1|162173|e_gw1.1554.15.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]