SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0CVW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D0CVW4
Domain Number - Region: 9-45
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000174
Family B-box zinc-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0CVW4
Sequence length 152
Comment (tr|A0A0D0CVW4|A0A0D0CVW4_9HOMO) Unplaced genomic scaffold scaffold_1409, whole genome shotgun sequence {ECO:0000313|EMBL:KIK79613.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_160882 OC=Paxillus.
Sequence
MEAPPNPWKCLICDGDRVYRCLGCFSQPLLCTQCCQKQHYMLPFHHVKQWTGTFFEDSSL
CLVGMVLHLGHHGQPCPSGVPEGMDPHVNRVPFPVDDMEWCTDELDDVPPFLWVPQDGNH
LTLVDVTGVHFLWVCYCVCPTSQPFHMQLLES
Download sequence
Identical sequences A0A0D0CVW4
jgi|Paxru1|160882|e_gw1.1409.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]