SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0DHD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D0DHD3
Domain Number - Region: 106-154
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0549
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0DHD3
Sequence length 269
Comment (tr|A0A0D0DHD3|A0A0D0DHD3_9HOMO) Unplaced genomic scaffold scaffold_2172, whole genome shotgun sequence {ECO:0000313|EMBL:KIK77425.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_17509 OC=Paxillus.
Sequence
MAPPVILSDDEVSIVSRPHQLKTLSSKLADTNNNVTPELSSHHTTATGPKLRPPASTTAL
KHDAQQAALKSSPESDDEGVTQSMHRKQGNPEVTRMLHQGNDDLVSSTGNLDVAKRLCQG
NDHSTSSTGNHNGNLDVAKRLCQNDNSTSSTGNLDVTHRLHRGNDDLRSSIGNRNVTRRL
HRTNNDSMSSTGYQNFAKRPHHANDNLSNPDDEGSAAPAPSRMTQVFHFQVVWHQLLKLM
TTSMTPQQMVVPAALLNNIVGMPLALLHD
Download sequence
Identical sequences A0A0D0DHD3
jgi|Paxru1|17509|gm1.9756_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]