SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0DHK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0DHK9
Domain Number 1 Region: 247-310
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.62e-19
Family DNA-binding domain from rap30 0.005
Further Details:      
 
Domain Number 2 Region: 25-177
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000000549
Family Rap30/74 interaction domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0DHK9
Sequence length 355
Comment (tr|A0A0D0DHK9|A0A0D0DHK9_9HOMO) Unplaced genomic scaffold scaffold_645, whole genome shotgun sequence {ECO:0000313|EMBL:KIK90822.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_831362 OC=Paxillus.
Sequence
MDLTVEDEKTRYEPDASQEDETQPDPDEELMLDRGNGRVWLVKIPKHLMARWASIDKEDI
HLATIRIYQNSVSSSGRSPRIFLFLPPDPNDLTPRAPELPSFPPDAAYIPAGEGGIHVDR
YELDMVNESVENQLVVAERPKDPVPPTSGTAAAHTYNPRSRTTILTGRVKHECNLRPLFN
ESYRRQMRERSRAYNTPRRQIRMIEEAGLSGGRGGINRLSSGVATGSFADMIKTKQKPAK
GTFERMARMPRNQLLDLLFQLFREQTRWSFKPLRERTQQPEIYLKEVLNDIATLHRSGEF
NGMWELSEIFAKEGVKAENVPGPSTLANGDIAMEDYDEGDDDDDDDDDDDMEEIS
Download sequence
Identical sequences A0A0D0DHK9
jgi|Paxru1|831362|fgenesh1_kg.645_#_16_#_Locus5045v1rpkm24.57 jgi|Paxru1|834959|fgenesh1_kg.2126_#_1_#_Locus5045v1rpkm24.57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]