SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0DPE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D0DPE9
Domain Number - Region: 8-46
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.00654
Family FAD-dependent thiol oxidase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0DPE9
Sequence length 60
Comment (tr|A0A0D0DPE9|A0A0D0DPE9_9HOMO) Unplaced genomic scaffold scaffold_328, whole genome shotgun sequence {ECO:0000313|EMBL:KIK93838.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_144150 OC=Paxillus.
Sequence
MDNAGNCNTTASELKKLIPTFGGSAACTWCFPHIINLIEKVHISVSYLLRPADKKSQLIK
Download sequence
Identical sequences A0A0D0DPE9
jgi|Paxru1|144150|e_gw1.328.38.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]