SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0DZ97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D0DZ97
Domain Number - Region: 47-120
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0126
Family Neurotransmitter-gated ion-channel transmembrane pore 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0DZ97
Sequence length 227
Comment (tr|A0A0D0DZ97|A0A0D0DZ97_9HOMO) Unplaced genomic scaffold scaffold_474, whole genome shotgun sequence {ECO:0000313|EMBL:KIK92274.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_830106 OC=Paxillus.
Sequence
MFPHSALARTIASSSYAACTITSLVLTAENIHGLHSTRPDWEPAITVPGCSAPPASGFWK
SFIPTMVTHSVLYGFTVIRAMKQLWMAPRAPLLMRLLREGGLVYLLAMVSAIFSAAGARL
TTIPSINYPAYSNLTLAVNAVAVSRLMLSVKSLAGKLRTDPRWLLNPPELGRVGWRYVQD
DGKAYRYEIMVERDTFEPELNGSNVEVGSASTSEFSLRNKTSHVWGL
Download sequence
Identical sequences A0A0D0DZ97
jgi|Paxru1|830106|fgenesh1_kg.474_#_10_#_Locus7379v1rpkm6.55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]