SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0EV44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0EV44
Domain Number 1 Region: 8-114
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000169
Family HEPN domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0EV44
Sequence length 129
Comment (tr|A0A0D0EV44|A0A0D0EV44_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KIO73038.1} KW=Complete proteome OX=35841 OS=Bacillus thermoamylovorans. GN=B4166_3740 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MNRKELQELAEIRIKEAEILLKSECYDGAYYMAGYSIECALKAWIAKSTKEHDFPDKKIA
DKVHTHDLVRLLGVLDVQVPEEIKFYWFIVKDWSEKARYEKYSMVEASDLLAAINDPTEG
VFKWIEEHW
Download sequence
Identical sequences A0A0D0EV44
WP_041902510.1.61818 WP_041902510.1.95871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]