SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0GB76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0GB76
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 8.5e-28
Family MoeA N-terminal region -like 0.00017
Further Details:      
 
Domain Number 2 Region: 525-665
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000288
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 3 Region: 380-455
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 0.0000000000968
Family MoeA C-terminal domain-like 0.012
Further Details:      
 
Domain Number 4 Region: 187-291,326-368
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 0.0000000131
Family MoeA central domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0GB76
Sequence length 669
Comment (tr|A0A0D0GB76|A0A0D0GB76_9BURK) KY49.ctg7180000000025_quiver, whole genome shotgun sequence {ECO:0000313|EMBL:KIP12976.1} KW=Complete proteome OX=1542965 OS=Burkholderia sp. MSHR3999. GN=KY49_1575 OC=Burkholderiaceae; Burkholderia.
Sequence
MPAWLADAYRRCADAVPGGMRVETVPVEHACGRVLAQAVTAPEALPRLALAAIEGYALRA
IDAAHASSARPATLNVRRRYPILIHRGGDPAARALSAGDAEWLPALAPLPAHADTVVPRS
RNRAPDGQQHARLDLDAPPVEGEGVIARGADYACDALLLDKGQRIGAEQQALLIAAGVRT
VEVSRRPRVCVVVASYDLVPSAGERQPWQRPDANGPYLCALLKQWGYDASLEYVAPPDMT
LPPLASRDAELAFRRQLAALAQRYDLLVGTGVLADDPHQDAALNRLPVFPVSEARVTLPQ
VRGARFNFGRSEDRSPAQRRTFELTDAAGRPRGSRVVTYFDQATLVNLPGYPGDVAILAH
TILRRLIDLLEFADMPGPYWETGVLGAPTSRDPARHDLRWATLATGAAGEPVVTPLAGER
ADALGALAGADALVAIESGATPLAAGSPVLFMRLDQSRRPVRAGGDAALAARSPSVDVSH
AATPDSARTDATSAAVAPSPDDTIAAAWARLDAWRRTLPADAPEPFRGPASDDDLRALEA
GLGVALPEAWRMSLRLHDGQEAGRTEPFAGETLLSARQILAQWSIWRDLVVRGDLADCEG
EPEPGIRGDWYNLKWIPLTHNGSGDHLCVDLDPDEGGRIGQVIRVWHDSPERELVAEGVG
EWLARGVPG
Download sequence
Identical sequences A0A0D0GB76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]