SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0HRH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0HRH7
Domain Number 1 Region: 131-251
Classification Level Classification E-value
Superfamily PR-1-like 1.7e-27
Family PR-1-like 0.0025
Further Details:      
 
Weak hits

Sequence:  A0A0D0HRH7
Domain Number - Region: 84-145
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0445
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0HRH7
Sequence length 254
Comment (tr|A0A0D0HRH7|A0A0D0HRH7_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KIP22699.1} KW=Complete proteome OX=265546 OS=Anoxybacillus ayderensis. GN=JV16_00379 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Anoxybacillus.
Sequence
MITKLTKSIVALSLLAIVGCNNAMDMNNRSNISALHTTLSSDQYPHTKAILIQEARYKFV
PIDPKDAANVRTQIERSLTEQQRMYVQPRPYTPSPNAYQRPNQVTPTQPNRQTQQPTQQQ
PRQTTPTTSISQYAQQVIDLTNRERARAGLPALRADAQLSSVAQKKSEDMRKNNYFSHTS
PTYGSPFDMMRDFGVSYRTAGENIAKGQRTPQEVVNAWMNSAGHRANILNRNFTHIGVGF
DGNGNYWTQMFIGK
Download sequence
Identical sequences A0A0B0HM31 A0A0D0HRH7
WP_021094846.1.15443 WP_021094846.1.5075 WP_021094846.1.72693 WP_021094846.1.83661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]