SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0IJZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0IJZ1
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 6.67e-35
Family Family 1 bi-partite nucleotidyltransferase subunit 0.000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0IJZ1
Sequence length 143
Comment (tr|A0A0D0IJZ1|A0A0D0IJZ1_HAEIF) Uncharacterized protein {ECO:0000313|EMBL:KIP48694.1} KW=Complete proteome OX=727 OS=Haemophilus influenzae. GN=SU59_06435 OC=Pasteurellaceae; Haemophilus.
Sequence
MMTDKLNLNVLDAAFYSLEQTVVQISDRNWFDMQPSIVQDTLIAGAIQKFEFVYELSLKM
MKRQLQQDAINADDIGAYGFKDILREALRFGLIEDMSKWVAYRDMRNVTSYTYDQEKAMA
VYAQIDDFLIESRFLLEQLRQRN
Download sequence
Identical sequences A0A0D0IJZ1
WP_042600974.1.56181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]