SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0IW08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0IW08
Domain Number 1 Region: 18-166
Classification Level Classification E-value
Superfamily OmpH-like 1.16e-28
Family OmpH-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0IW08
Sequence length 171
Comment (tr|A0A0D0IW08|A0A0D0IW08_9BACT) Contig53, whole genome shotgun sequence {ECO:0000313|EMBL:KIP62507.1} KW=Complete proteome OX=1602171 OS=Prevotella sp. P5-119. GN=ST44_06775 OC=Prevotella.
Sequence
MKKLLFIAVMLFSALGMSAQKFALVDMEYILKNIPAYERANEQLSQVAKKWQAEVDAMGT
EVQTLYKNYQNESVFLSQEQKKARQEAILAKEKEASELKKKYFGPEGELFKKRTSLMTPI
QEEIYNAVKDISELRGYSLVLDRASDTGIIFASPKVDISNEVLTKLGYSAN
Download sequence
Identical sequences A0A0D0IW08
WP_042519129.1.99227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]