SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0J4I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0J4I0
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.05e-29
Family N-utilization substance G protein NusG, N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 115-163
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000842
Family N-utilization substance G protein NusG, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0J4I0
Sequence length 166
Comment (tr|A0A0D0J4I0|A0A0D0J4I0_VIBHA) Transcription antitermination protein RfaH {ECO:0000256|HAMAP-Rule:MF_00951} KW=Complete proteome OX=669 OS=Vibrio harveyi (Beneckea harveyi). GN=SN10_16305 OC=Vibrionaceae; Vibrio.
Sequence
MKRWYLLYCKRGEQVRAKQHLENQGVECFYPTVEVEKILRGKRQKVEEPLFPCYVFAQFD
YEKGPNFTSVRSTRGVVDFVRFGAQPKEIQGDLVFELKQLETCTDDHSDSECMPQPGDEV
RVKSGQFAGIDAIFQEQDGEKRSIMLVQMITKRVPVSIDNNDLDLK
Download sequence
Identical sequences A0A0D0J4I0
WP_042602217.1.47505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]