SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0KVP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0KVP6
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.23e-43
Family SMI1/KNR4-like 0.000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0KVP6
Sequence length 135
Comment (tr|A0A0D0KVP6|A0A0D0KVP6_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:KIQ01245.1} KW=Complete proteome OX=47880 OS=Pseudomonas fulva. GN=RU08_08800 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLRELNEPVPVPLELPEEELLVEIEEQILINLPFELREFLLKVSDVVYGRLEPV
TVTDPQSHTYLPEVASVAWSLGVSRELVPICEDNGNYYCVEQDGTVLLWDGEEEDLTDDS
WDSVWHWVREVWLEE
Download sequence
Identical sequences A0A0D0KVP6
WP_042553414.1.65621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]