SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0L370 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0L370
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-46
Family SMI1/KNR4-like 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0L370
Sequence length 135
Comment (tr|A0A0D0L370|A0A0D0L370_PSEVI) Uncharacterized protein {ECO:0000313|EMBL:KPZ19756.1} KW=Complete proteome OX=33069 OS=Pseudomonas viridiflava. GN=ALO56_03146 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLREANEPVPVPLELPDEDLLVEIEEQLFINIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAATAWDDGVPRELIPICQDGDDYYCVEEDGTVLLWSAEEELVTEES
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0D0L370 A0A0N8SIR3 A0A0P9YGS1 A0A0W0M6V8
WP_004881680.1.19271 WP_004881680.1.27181 WP_004881680.1.31908 WP_004881680.1.35405 WP_004881680.1.46510 WP_004881680.1.47060 WP_004881680.1.58110 WP_004881680.1.61310 WP_004881680.1.70529 WP_004881680.1.73282 WP_004881680.1.88991 WP_004881680.1.98095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]