SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0PR92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0PR92
Domain Number 1 Region: 8-198
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.31e-53
Family Heme oxygenase HemO (PigA) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0PR92
Sequence length 201
Comment (tr|A0A0D0PR92|A0A0D0PR92_PSEFL) Heme oxygenase {ECO:0000313|EMBL:KIQ61113.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=RL74_01930 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSSAAPHPSLIQALRTETATLHIALEKRLPFFSERLDLALYRRLMAAYYGFYQPLEQRLH
VLALIPTGLDQSLRVKLPVLRADLTALGLDDAAIDALPTCQALPRIDSRAAALGVSYVLE
GATLGGQILRRRVAEQLGLDASSGAAFLNVYGEFTGRRWKDFLQYLDDRNLGQAQTLEVT
NAAKATFTYFEHWLDSQEVLL
Download sequence
Identical sequences A0A0D0PR92
WP_042728145.1.35729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]