SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0RJR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0RJR2
Domain Number 1 Region: 10-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.15e-28
Family SMI1/KNR4-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0RJR2
Sequence length 156
Comment (tr|A0A0D0RJR2|A0A0D0RJR2_9BACI) Contig_22, whole genome shotgun sequence {ECO:0000313|EMBL:KIQ89700.1} KW=Complete proteome OX=1588630 OS=Bacillus sp. L_1B0_8. GN=RW25_10440 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKSTIWADDDYLKLAPLNDELIKKAEEVLNVKLPESYINLLKEQNGGTLRLDTHPTSEPN
SWADDHVNVSGLYGISFDENESSILESRYLIQEWEMPENIVLLSGDGHTWIALDYRNVAE
NPPVIFIDNEFEEIIELAPNFESFLQNLTTYEYDEE
Download sequence
Identical sequences A0A0D0RIL8 A0A0D0RJR2 A0A2B3KWS9
WP_029443517.1.17797 WP_029443517.1.23297 WP_029443517.1.34125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]