SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0SE42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0SE42
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.8e-34
Family AadK C-terminal domain-like 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0SE42
Sequence length 113
Comment (tr|A0A0D0SE42|A0A0D0SE42_STAGA) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KIR10475.1} KW=Complete proteome; Reference proteome OX=1293 OS=Staphylococcus gallinarum. GN=SH09_12925 OC=Staphylococcus.
Sequence
VFRREILFALDHFNNILRPELLRMISWYIGFNRGFDFSLGKNYKFINKYLTDKEFNMLLA
TFEMNGYRKTYQSFKLCCELFKYYSNKVSCLGNYNYPNYEKNIENFIRNNYEN
Download sequence
Identical sequences A0A0D0SE42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]